PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0552s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 396aa    MW: 44083.7 Da    PI: 7.1527
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0552s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51141411128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             + pGfrFhPtdeelv +yLk+k++++ l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg
  SapurV1A.0552s0060.1.p  14 MLPGFRFHPTDEELVGFYLKRKIQQRCLPI-ELIKQVDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATG 99 
                             579***************************.89***************8888999******************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +d++++s  +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  SapurV1A.0552s0060.1.p 100 TDRPIYSGdGTRCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 141
                             *******855667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5713173IPR003441NAC domain
PROSITE profilePS5100556.05614173IPR003441NAC domain
PfamPF023651.8E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDAKNDVDKI DDVMLPGFRF HPTDEELVGF YLKRKIQQRC LPIELIKQVD IYKYDPWDLP  60
KLATTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSGDGT RCIGLKKSLV  120
FYRGRAAKGI KTDWMMHEFR LPSLPEPSPP KKLILEKSLP ANDAWAICRI FKKANSMAQR  180
AVSHSWVSPV PDTGASELFA QGAHCTENMS CVTEIGSSFH LGSNGSDFQQ AGFSVPDINS  240
YRPINIPAVY RSYLCPESNG DLSSNLLYSQ LDISGPIKYA DDAHSTLLNP ALIGAAAKAS  300
DESREYEGSQ QQLSGFSINP LQEMQMCTGE DEAGLRKNPS STHESNLVGT IRSIGFPFSL  360
PSNLPHDAWR SNLAWDSPSC PSEMSTTYST NKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-521617619168NAC domain-containing protein 19
4dul_A5e-521617619168NAC domain-containing protein 19
1ut7_B5e-521617619168NO APICAL MERISTEM PROTEIN
1ut7_A5e-521617619168NO APICAL MERISTEM PROTEIN
1ut4_B5e-521617619168NO APICAL MERISTEM PROTEIN
1ut4_A5e-521617619168NO APICAL MERISTEM PROTEIN
3ulx_A5e-521617617171Stress-induced transcription factor NAC1
3swp_D5e-521617622171NAC domain-containing protein 19
3swp_C5e-521617622171NAC domain-containing protein 19
3swp_B5e-521617622171NAC domain-containing protein 19
3swp_A5e-521617622171NAC domain-containing protein 19
3swm_D5e-521617622171NAC domain-containing protein 19
3swm_C5e-521617622171NAC domain-containing protein 19
3swm_B5e-521617622171NAC domain-containing protein 19
3swm_A5e-521617622171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006384333.10.0hypothetical protein POPTR_0004s12850g
TrEMBLU5GF980.0U5GF98_POPTR; Uncharacterized protein
STRINGPOPTR_0004s12850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-100NAC family protein